Product Catalog

  • Download our Catalog (PDF File)

  •  

    New Products

     

    Why Use Chicken IgY?

  • Here are top 5 reasons:



    1. Higher titres against highly conserved mammalian gene products

    2. Double immunostaining is easier to perform

    3. Animal-friendly -- we purify the antibodies from eggs, not serum

    4. Large quantities of antibody - faster and cheaper

    5. Nearly unlimited quantities (again, because the antibodies come from eggs)

    learn more

  •  

    Like Aves Labs on Social Media

  •  

Anti-Ankyrin-G (Staining) (N106/36) – TC Supernatant

Price: $319
Catalog #: 73-146
Data Sheet (PDF)
Immunofluorescence staining of axon initial segments in adult rat cortex with N106/36 (red) and IVspectrin rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).
Add to Cart
Share |

Product Info

OVERVIEW

Form: TC Supernatant
Hybridoma tissue-culture supernatant (5mL) generally containing 20-60 ug/mL monoclonal antibody (mAb). Supernatant is suitable for most applications, including Western Blot, immunocytochemistry, immunohistochemistry, etc., and is a very economical choice compared to competitor offerings. For applications requiring higher antibody concentration or purity (such as immunoprecipitation, microinjection, or conjugation) it is recommended that you purchase the purified form of the antibody (supplied at 1mg/mL).

Volume:
5 mL

Concentration:
Lot dependent

Brand:
NeuroMab

Antibody Type:
Monoclonal

Host Species:
Mouse

Antibody Isotype:
IgG2a

Species Reactivity:
Human, Mouse, Rat

Applications:
ICC, IHC

Immunogen:
Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence: EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH Human: 92% identity (920/994 amino acids identical, accession # E9PE32) Mouse: 89% identity (837/936 amino acids identical) Rat: 87% identity (820/935 amino acids identical) 50% identity with Ankyrin-B

Cross Reactivity:
Does not cross-react with Ankyrin-B

Protein Name(s):
Ankyrin-3 (ANK-3) (Ankyrin-G)

Gene Name(s):
ANK3

Antibody Registry ID:
AB_10697718

ANTIBODY VALIDATION AND APPLICATION NOTES
This antibody has been validated using the following assays:
Immunocytochemistry:
This antibody shows the expected staining pattern when used to stain COS cells over-expressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.
QUALITY CONTROL
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Reviews