Product Catalog

  • Download our Catalog (PDF File)

  •  

    New Products

     

    Why Use Chicken IgY?

  • Here are top 5 reasons:



    1. Higher titres against highly conserved mammalian gene products

    2. Double immunostaining is easier to perform

    3. Animal-friendly -- we purify the antibodies from eggs, not serum

    4. Large quantities of antibody - faster and cheaper

    5. Nearly unlimited quantities (again, because the antibodies come from eggs)

    learn more

  •  

    Like Aves Labs on Social Media

  •  

Anti-GluA2/GluR2 glutamate receptor (L21/32) – Purified

Price: $319
Catalog #: 75-002
Data Sheet (PDF)
Adult rat hippocampus immunohistochemistry
Add to Cart
Share |

Product Info

OVERVIEW

Form: Purified
Produced by in vitro bioreactor culture of hybridoma lines followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody at 1mg/mL.

Volume:
100 ┬ÁL

Concentration:
1 mg/mL

Brand:
NeuroMab

Antibody Type:
Monoclonal

Host Species:
Mouse

Antibody Isotype:
IgG1

Species Reactivity:
Human, Mouse, Rat

Applications:
EM, IHC, WB

Immunogen:
Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical)
100% identity between Flip and Flop isoforms
70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4

Cross Reactivity:
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

Protein Name(s):
Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Gene Name(s):
Gria2 Glur2

Antibody Registry ID:
AB_2232661

ANTIBODY VALIDATION AND APPLICATION NOTES
This antibody has been validated using the following assays:
Knockout Validation:
This antibody has been knockout-validated in mouse brain (by Western blot and/or immunohistochemistry).

Western Blot:
This antibody recognizes a single immunoreactive band of expected molecularweight when used to probe brain lysate.

Immunocytochemistry:
This antibody shows the expected staining pattern when used to stain COS cells overexpressing target.

Immunohistochemistry:
This antibody shows the expected immunoperoxidase-diaminobenzidine/immunofluorescence staining pattern when used to stain brain sections.

Expected Banding Pattern:
90 kDa

QUALITY CONTROL
The following quality control assay is performed on each new lot of this antibody to ensure it meets designated performance requirements.
Each new lot of this antibody is tested to confirm that it recognizes a single immunoreactive band of expected molecular weight when used to probe brain lysate.

Reviews