Immunofluorescence staining of axon initial segments in adult rat cortex with N106/36 (red) and bIV- spectrin rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

Immunofluorescence staining of axon initial segments in adult rat cortex with N106/36 (red) and bIV- spectrin rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

Immunofluorescence staining of nodes of Ranvier in adult rat optic nerve with N106/36 (red) and Caspr rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

Immunofluorescence staining of nodes of Ranvier in adult rat optic nerve with N106/36 (red) and Caspr rabbit polyclonal (green). Image courtesy of Matt Rasband (Baylor College of Medicine).

adult rat Cortex immunohistochemistry of axon initial segments.

adult rat Cortex immunohistochemistry of axon initial segments.

Adult rat thalamus immunohistochemistry of axon initial segments.

Adult rat thalamus immunohistochemistry of axon initial segments.

Ankyrin-G (Staining) (7x-146)

  • Sale
  • Regular price $319



Product Details | ↓ Citations


Details

Concentration: 1 mg/mL

Clonality: Monoclonal

Form: Purified

Host Species: Mouse

Immunogen: Fusion protein ~1000 amino acids of Ankyrin-G (also known as ANK-3 or ankyrin-3), sequence: EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSM RGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTI PVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIK DCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCY GNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT TKGLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSP QSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQ SFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGT RSFADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDE SQLENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSY LKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGS GHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH Human: 92% identity (920/994 amino acids identical, accession # E9PE32) Mouse: 89% identity (837/936 amino acids identical) Rat: 87% identity (820/935 amino acids identical) 50% identity with Ankyrin-B

Gene ID: ANK3

Antibody Registry ID (RRID): AB_10673030

Physical State: Liquid

NOTE

Aves Labs products are intended for use as research laboratory reagents. They are not intended for use as diagnostic or therapeutic reagents in humans.


back to top


Citations


back to top