Immunoblot of membranes from adult rat brain (RBM) and adult GluA2/GluR2 knockout (KO) and wild-type (WT) mouse hippocampi (MHM).  Mouse samples courtesy of Richard Huganir (Johns Hopkins University).

Immunoblot of membranes from adult rat brain (RBM) and adult GluA2/GluR2 knockout (KO) and wild-type (WT) mouse hippocampi (MHM). Mouse samples courtesy of Richard Huganir (Johns Hopkins University).

Electron micrograph of L21/32 hippocampal labelling using a post-embedding immunogold method. Immunoparticles (arrows) were observed in the postsynaptic densities of dendritic spines and dendritic shafts (Den) establishing asymmetrical synapses with axon terminals (b). Image courtesy of Rafael Lujan (Universidad de Castilla-La Mancha).

Electron micrograph of L21/32 hippocampal labelling using a post-embedding immunogold method. Immunoparticles (arrows) were observed in the postsynaptic densities of dendritic spines and dendritic shafts (Den) establishing asymmetrical synapses with axon terminals (b). Image courtesy of Rafael Lujan (Universidad de Castilla-La Mancha).

Adult rat hippocampus immunohistochemistry.

Adult rat hippocampus immunohistochemistry.

Immunoblot against crude membrane fractions from whole mouse (MBM) or rat (RBM) brain and from human cerebral cortex [HBM(Cx)] or hippocampus [HBM(H)] and probed with L21/32 (left) or N52A/42. (right) TC supe.

Immunoblot against crude membrane fractions from whole mouse (MBM) or rat (RBM) brain and from human cerebral cortex [HBM(Cx)] or hippocampus [HBM(H)] and probed with L21/32 (left) or N52A/42. (right) TC supe.

Adult rat brain membrane immunoblot.

Adult rat brain membrane immunoblot.

GluA2/GluR2 glutamate receptor (7x-002)

  • Sale
  • Regular price $319



Product Details | ↓ Citations


Details

Concentration: 1 mg/mL

Clonality: Monoclonal

Form: Purified

Host Species: Mouse

Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical)
100% identity between Flip and Flop isoforms
70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4

Gene ID: Gria2 Glur2

Antibody Registry ID (RRID): AB_2232661

Physical State: Liquid

Validation and Application Notes

Expected Banding Pattern: 90 kDa

NOTE

Aves Labs products are intended for use as research laboratory reagents. They are not intended for use as diagnostic or therapeutic reagents in humans.


back to top


Citations


back to top